(data stored in ACNUC7421 zone)

EMBL: CP001509.FEPE

CP001509.FEPE        Location/Qualifiers
FT   CDS             578741..579874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepE"
FT                   /locus_tag="ECD_00554"
FT                   /product="regulator of length of O-antigen component of
FT                   lipopolysaccharide chains"
FT                   /note="similar to b0587"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00554"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42433"
FT                   /protein_id="ACT42433.1"
FT                   /translation="MSSLNIKQGSDAHFPDYPLASPSNNEIDLLNLISVLWRAKKTVMA
FT                   VVFAFACAGLLISFILPQKWTSAAVVTPPEPVQWQELEKTFTKLRVLDLDIKIDRTEAF
FT                   NLFIKKFQSVSLLEEYLRSSPYVMDQLKEAKIDELDLHRAIVALSEKMKAVDDNASKKK
FT                   DEPSLYTSWTLSFTAPTSEEAQTVLSGYIDYISTLVVKESLENVRNKLEIKTQFEKEKL
FT                   AQDRIKTKNQLDANIQRLNYSLDIANAAGIKKPVYSNGQAVKDDPDFSISLGADGIERK
FT                   LEIEKAVTDVAELNGELRNRQYLVEQLTKANINDVNFTPFKYQLSPSLPVKKDGPGKAI
FT                   IVILSALIGGMVACGSVLLRYAMASRKQDAMMADHLV"
     MSSLNIKQGS DAHFPDYPLA SPSNNEIDLL NLISVLWRAK KTVMAVVFAF ACAGLLISFI        60
     LPQKWTSAAV VTPPEPVQWQ ELEKTFTKLR VLDLDIKIDR TEAFNLFIKK FQSVSLLEEY       120
     LRSSPYVMDQ LKEAKIDELD LHRAIVALSE KMKAVDDNAS KKKDEPSLYT SWTLSFTAPT       180
     SEEAQTVLSG YIDYISTLVV KESLENVRNK LEIKTQFEKE KLAQDRIKTK NQLDANIQRL       240
     NYSLDIANAA GIKKPVYSNG QAVKDDPDFS ISLGADGIER KLEIEKAVTD VAELNGELRN       300
     RQYLVEQLTK ANINDVNFTP FKYQLSPSLP VKKDGPGKAI IVILSALIGG MVACGSVLLR       360
     YAMASRKQDA MMADHLV                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page