(data stored in ACNUC7421 zone)

EMBL: CP001509.FETA

CP001509.FETA        Location/Qualifiers
FT   CDS             485066..485743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fetA"
FT                   /locus_tag="ECD_00441"
FT                   /product="iron export ABC transporter ATPase; peroxide
FT                   resistance protein"
FT                   /note="similar to b0490"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00441"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42340"
FT                   /protein_id="ACT42340.1"
FT                   /translation="MQENSPLLQLQNVGYLAGDTKILNNINFSLRAGEFKLITGPSGCG
FT                   KSTLLKIVASLISPTSGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFP
FT                   WQIRNQQPDPAIFLDFLERFALPDSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDE
FT                   ITSALDESNKHNVNEMIHRYVREQNIAVLWVTHDKDEINHADKVITLQPHAGEMQEARY
FT                   ELA"
     MQENSPLLQL QNVGYLAGDT KILNNINFSL RAGEFKLITG PSGCGKSTLL KIVASLISPT        60
     SGTLLFEGED VSTLKPEIYR QQVSYCAQTP TLFGDTVYDN LIFPWQIRNQ QPDPAIFLDF       120
     LERFALPDSI LTKNIAELSG GEKQRISLIR NLQFMPKVLL LDEITSALDE SNKHNVNEMI       180
     HRYVREQNIA VLWVTHDKDE INHADKVITL QPHAGEMQEA RYELA                       225
//

If you have problems or comments...

PBIL Back to PBIL home page