(data stored in ACNUC7421 zone)

EMBL: CP001509.FETB

CP001509.FETB        Location/Qualifiers
FT   CDS             485730..486509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fetB"
FT                   /locus_tag="ECD_00442"
FT                   /product="iron export ABC transporter permease; peroxide
FT                   resistance protein"
FT                   /note="similar to b0491"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00442"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42341"
FT                   /protein_id="ACT42341.1"
FT                   /translation="MNSHNITNESLALALMLVVVAILISHKEKLALEKDILWSVGRAII
FT                   QLIIVGYVLKYIFSVDDASLTLLMVLFICFNAAWNAQKRSKYIAKAFISSFIAITVGAG
FT                   ITLAVLILSGSIEFIPMQVIPIAGMIAGNAMVAVGLCYNNLGQRVISEQQQIQEKLSLG
FT                   ATPKQASAILIRDSIRAALIPTVDSAKTVGLVSLPGMMSGLIFAGIDPVKAIKYQIMVT
FT                   FMLLSTASLSTIIACYLTYRKFYNSRHQLVVTQLKKK"
     MNSHNITNES LALALMLVVV AILISHKEKL ALEKDILWSV GRAIIQLIIV GYVLKYIFSV        60
     DDASLTLLMV LFICFNAAWN AQKRSKYIAK AFISSFIAIT VGAGITLAVL ILSGSIEFIP       120
     MQVIPIAGMI AGNAMVAVGL CYNNLGQRVI SEQQQIQEKL SLGATPKQAS AILIRDSIRA       180
     ALIPTVDSAK TVGLVSLPGM MSGLIFAGID PVKAIKYQIM VTFMLLSTAS LSTIIACYLT       240
     YRKFYNSRHQ LVVTQLKKK                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page