(data stored in ACNUC7421 zone)

EMBL: CP001509.FHUD

CP001509.FHUD        Location/Qualifiers
FT   CDS             173418..174308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="ECD_00151"
FT                   /product="iron(3+)-hydroxamate import ABC transporter
FT                   periplasmic binding protein"
FT                   /note="similar to b0152"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00151"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42052"
FT                   /protein_id="ACT42052.1"
FT                   /translation="MSGLPLISRRRLLTAMALSPLLWQMNTAHAAAIDPNRIVALEWLP
FT                   VELLLALGIVPYGVADTINYRLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSPDMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAQYEDFIR
FT                   SMKPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAV
FT                   SIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRTGRFQRVPAVWFYGATLSA
FT                   MHFVRVLDNAIGGKA"
     MSGLPLISRR RLLTAMALSP LLWQMNTAHA AAIDPNRIVA LEWLPVELLL ALGIVPYGVA        60
     DTINYRLWVS EPPLPDSVID VGLRTEPNLE LLTEMKPSFM VWSAGYGPSP DMLARIAPGR       120
     GFNFSDGKQP LAMARKSLTE MADLLNLQSA AETHLAQYED FIRSMKPRFV KRGARPLLLT       180
     TLIDPRHMLV FGPNSLFQEI LDEYGIPNAW QGETNFWGST AVSIDRLAAY KDVDVLCFDH       240
     DNSKDMDALM ATPLWQAMPF VRTGRFQRVP AVWFYGATLS AMHFVRVLDN AIGGKA           296
//

If you have problems or comments...

PBIL Back to PBIL home page