(data stored in ACNUC7421 zone)

EMBL: CP001509.FII

CP001509.FII         Location/Qualifiers
FT   CDS             776086..776439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Fii"
FT                   /locus_tag="ECD_10043"
FT                   /product="head-tail joining protein"
FT                   /note="similar to lambdap10"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10043"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42625"
FT                   /protein_id="ACT42625.1"
FT                   /translation="MADFDNLFDAAIARADETIRGYMGTSATITSGEQSGAVIRGVFDD
FT                   PENISYAGQGVRVEGSSPSLFVRTDEVRQLRRGDTLTIGEENFWVDRVSPDDGGSCHLW
FT                   LGRGVPPAVNRRR"
     MADFDNLFDA AIARADETIR GYMGTSATIT SGEQSGAVIR GVFDDPENIS YAGQGVRVEG        60
     SSPSLFVRTD EVRQLRRGDT LTIGEENFWV DRVSPDDGGS CHLWLGRGVP PAVNRRR          117
//

If you have problems or comments...

PBIL Back to PBIL home page