(data stored in ACNUC7421 zone)

EMBL: CP001509.FIXA

CP001509.FIXA        Location/Qualifiers
FT   CDS             46599..47369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixA"
FT                   /locus_tag="ECD_00045"
FT                   /product="anaerobic carnitine reduction putative electron
FT                   transfer flavoprotein subunit"
FT                   /note="similar to b0041"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41946"
FT                   /protein_id="ACT41946.1"
FT                   /translation="MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAA
FT                   CQLKQQAAEAQVTALSVGGKALTNAKGRKDVLSRGPDELIVVIDDQFEQALPQQTASAL
FT                   AAAAQKAGFDLILCGDGSSDLYAQQVGLLVGEILNIPAVNGVSKIISLTADTLTVEREL
FT                   EDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFNAEAAWSEQ
FT                   QVAAPKQRERQRIVIEGDGEEQIAAFAENLRKVI"
     MKIITCYKCV PDEQDIAVNN ADGSLDFSKA DAKISQYDLN AIEAACQLKQ QAAEAQVTAL        60
     SVGGKALTNA KGRKDVLSRG PDELIVVIDD QFEQALPQQT ASALAAAAQK AGFDLILCGD       120
     GSSDLYAQQV GLLVGEILNI PAVNGVSKII SLTADTLTVE RELEDETETL SIPLPAVVAV       180
     STDINSPQIP SMKAILGAAK KPVQVWSAAD IGFNAEAAWS EQQVAAPKQR ERQRIVIEGD       240
     GEEQIAAFAE NLRKVI                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page