(data stored in ACNUC7421 zone)

EMBL: CP001509.FIXB

CP001509.FIXB        Location/Qualifiers
FT   CDS             47384..48325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixB"
FT                   /locus_tag="ECD_00046"
FT                   /product="putative electron transfer flavoprotein,
FT                   NAD/FAD-binding domain and ETFP adenine nucleotide-binding
FT                   domain-like protein"
FT                   /note="similar to b0042"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00046"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41947"
FT                   /protein_id="ACT41947.1"
FT                   /translation="MNTFSQVWVFSDTPSRLPELMNGAQALANQINTFVLNDADGAQAI
FT                   QLGANHVWKLNGKPDDRMIEDYAGVMADTIRQHGADGLVLLPNTRRGKLLAAKLGYRLK
FT                   AAVSNDASTVSVQDGKATVKHMVYGGLAIGEERIATPYAVLTISSGTFDAAQPDASRTG
FT                   ETHTVEWQAPAVAITRTATQARQSNSVDLDKARLVVSVGRGIGSKENIALAEQLCKAIG
FT                   AELACSRPVAENEKWMEHERYVGISNLMLKPELYLAVGISGQIQHMVGANASQTIFAIN
FT                   KDKNAPIFQYADYGIVGDAVKILPALTAALAR"
     MNTFSQVWVF SDTPSRLPEL MNGAQALANQ INTFVLNDAD GAQAIQLGAN HVWKLNGKPD        60
     DRMIEDYAGV MADTIRQHGA DGLVLLPNTR RGKLLAAKLG YRLKAAVSND ASTVSVQDGK       120
     ATVKHMVYGG LAIGEERIAT PYAVLTISSG TFDAAQPDAS RTGETHTVEW QAPAVAITRT       180
     ATQARQSNSV DLDKARLVVS VGRGIGSKEN IALAEQLCKA IGAELACSRP VAENEKWMEH       240
     ERYVGISNLM LKPELYLAVG ISGQIQHMVG ANASQTIFAI NKDKNAPIFQ YADYGIVGDA       300
     VKILPALTAA LAR                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page