(data stored in ACNUC7421 zone)

EMBL: CP001509.FLC

CP001509.FLC         Location/Qualifiers
FT   CDS             complement(617916..618299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flc"
FT                   /locus_tag="ECD_00594"
FT                   /product="fluoride efflux channel, dual topology membrane
FT                   protein"
FT                   /note="similar to b0624"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00594"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42472"
FT                   /protein_id="ACT42472.1"
FT                   /translation="MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGA
FT                   FIIGMGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVF
FT                   VNLLGSFAMTALAFWLFSASTAH"
     MLQLLLAVFI GGGTGSVARW LLSMRFNPLH QAIPLGTLAA NLIGAFIIGM GFAWFSRMTN        60
     IDPVWKVLIT TGFCGGLTTF STFSAEVVFL LQEGRFGWAL LNVFVNLLGS FAMTALAFWL       120
     FSASTAH                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page