(data stored in ACNUC7421 zone)

EMBL: CP001509.FRSA

CP001509.FRSA        Location/Qualifiers
FT   CDS             261021..262265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frsA"
FT                   /locus_tag="ECD_00234"
FT                   /product="fermentation-respiration switch protein; PTS
FT                   Enzyme IIA(Glc)-binding protein; pNP-butyrate esterase
FT                   activity"
FT                   /note="similar to b0239"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00234"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42133"
FT                   /protein_id="ACT42133.1"
FT                   /translation="MTQANLSETLFKPRFKHPETSTLVRRFNHGAQPPVQSALDGKTIP
FT                   HWYRMINRLMWIWRGIDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWATQ
FT                   AMVWQQKACAEEDPQLSGRHWLHAATLYNIAAYPHLKGDDLAEQAQALSNRAYEEAAQR
FT                   LPGTMRQMEFTVPGGAPITGFLHMPKGDGPFPTVLMCGGLDAMQTDYYSLYERYFAPRG
FT                   IAMLTIDMPSVGFSSKWKLTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGANVAVR
FT                   LAYLESPRLKAVACLGPVVHTLLSDFKCQQQVPEMYLDVLASRLGMHDASDEALRVELN
FT                   RYSLKVQGLLGRRCPTPMLSGYWKNDPFSPEEDSRLITSSSADGKLLEIPFNPVYRNFD
FT                   KGLQEITDWIEKRLC"
     MTQANLSETL FKPRFKHPET STLVRRFNHG AQPPVQSALD GKTIPHWYRM INRLMWIWRG        60
     IDPREILDVQ ARIVMSDAER TDDDLYDTVI GYRGGNWIYE WATQAMVWQQ KACAEEDPQL       120
     SGRHWLHAAT LYNIAAYPHL KGDDLAEQAQ ALSNRAYEEA AQRLPGTMRQ MEFTVPGGAP       180
     ITGFLHMPKG DGPFPTVLMC GGLDAMQTDY YSLYERYFAP RGIAMLTIDM PSVGFSSKWK       240
     LTQDSSLLHQ HVLKALPNVP WVDHTRVAAF GFRFGANVAV RLAYLESPRL KAVACLGPVV       300
     HTLLSDFKCQ QQVPEMYLDV LASRLGMHDA SDEALRVELN RYSLKVQGLL GRRCPTPMLS       360
     GYWKNDPFSP EEDSRLITSS SADGKLLEIP FNPVYRNFDK GLQEITDWIE KRLC             414
//

If you have problems or comments...

PBIL Back to PBIL home page