(data stored in ACNUC7421 zone)

EMBL: CP001509.FSR

CP001509.FSR         Location/Qualifiers
FT   CDS             complement(472522..473742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fsr"
FT                   /locus_tag="ECD_00430"
FT                   /product="putative fosmidomycin efflux system protein"
FT                   /note="similar to b0479"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42329"
FT                   /protein_id="ACT42329.1"
FT                   /translation="MAMSEQPQPVAGAAASTTKARTSFGILGAISLSHLLNDMIQSLIL
FT                   AIYPLLQSEFSLTFMQIGMITLTFQLASSLLQPVVGYWTDKYPMPWSLPIGMCFTLSGL
FT                   VLLALAGSFGAVLLAAALVGTGSSVFHPESSRVARMASGGRHGLAQSIFQVGGNFGSSL
FT                   GPLLAAVIIAPYGKGNVAWFVLAALLAIVVLAQISRWYSAQHRMNKGKPKATIINPLPR
FT                   NKVVLAVSILLILIFSKYFYMASISSYYTFYLMQKFGLSIQNAQLHLFAFLFAVAAGTV
FT                   SGGPVGDKIGRKYVIWGSILGVAPFTLILPYASLHWTGVLTVIIGFILASAFSAILVYA
FT                   QELLPGRIGMVSGLFFGFAFGMGGLGAAVLGLIADHTSIELVYKICAFLPLLGMLTIFL
FT                   PDNRHKD"
     MAMSEQPQPV AGAAASTTKA RTSFGILGAI SLSHLLNDMI QSLILAIYPL LQSEFSLTFM        60
     QIGMITLTFQ LASSLLQPVV GYWTDKYPMP WSLPIGMCFT LSGLVLLALA GSFGAVLLAA       120
     ALVGTGSSVF HPESSRVARM ASGGRHGLAQ SIFQVGGNFG SSLGPLLAAV IIAPYGKGNV       180
     AWFVLAALLA IVVLAQISRW YSAQHRMNKG KPKATIINPL PRNKVVLAVS ILLILIFSKY       240
     FYMASISSYY TFYLMQKFGL SIQNAQLHLF AFLFAVAAGT VSGGPVGDKI GRKYVIWGSI       300
     LGVAPFTLIL PYASLHWTGV LTVIIGFILA SAFSAILVYA QELLPGRIGM VSGLFFGFAF       360
     GMGGLGAAVL GLIADHTSIE LVYKICAFLP LLGMLTIFLP DNRHKD                      406
//

If you have problems or comments...

PBIL Back to PBIL home page