(data stored in ACNUC7421 zone)

EMBL: CP001509.GAM

CP001509.GAM         Location/Qualifiers
FT   CDS             complement(757937..758353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gam"
FT                   /locus_tag="ECD_10014"
FT                   /product="host-nuclease inhibitor protein Gam"
FT                   /note="similar to lambdap42"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10014"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42596"
FT                   /protein_id="ACT42596.1"
FT                   /translation="MDINTETEIKQKHSLTPFPVFLISPAFRGRYFHSYFRSSAMNAYY
FT                   IQDRLEAQSWARHYQQLAREEKEAELADDMEKGLPQHLFESLCIDHLQRHGASKKSITR
FT                   AFDDDVEFQERMAEHIRYMVETIAHHQVDIDSEV"
     MDINTETEIK QKHSLTPFPV FLISPAFRGR YFHSYFRSSA MNAYYIQDRL EAQSWARHYQ        60
     QLAREEKEAE LADDMEKGLP QHLFESLCID HLQRHGASKK SITRAFDDDV EFQERMAEHI       120
     RYMVETIAHH QVDIDSEV                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page