(data stored in ACNUC7421 zone)

EMBL: CP001509.GLXK

CP001509.GLXK        Location/Qualifiers
FT   CDS             511033..512178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="ECD_00464"
FT                   /product="glycerate kinase II"
FT                   /EC_number="2.7.1.31"
FT                   /note="similar to b0514"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00464"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42363"
FT                   /protein_id="ACT42363.1"
FT                   /translation="MKIVIAPDSFKESLSAEKCCQAIKAGFSTLFPDANYICLPIADGG
FT                   EGTVDAMVAATGGNIVTLEVCGPMGEKVNAFYGLTGDGKTAVIEMAAASGLMLVAPEKR
FT                   NPLLASSFGTGELIRHALDNGIRHIILGIGGSATVDGGMGMAQALGVRFLDADGQVLVA
FT                   NGGNLARVASIEMDECDPRLANCHIEVACDVDNPLVGARGAAAVFGPQKGATPEMVEEL
FT                   EQGLQNYARVLQQQTEINVCQMAGGGAAGGMGIAAAVFLNADIKPGIEIVLNAVNLAQA
FT                   VQGAALVITGEGRIDSQTAGGKAPLGVASVAKQFNVPVIGIAGVLGDGVEVVHQYGIDA
FT                   VFSILPRLAPLAEVLASGETNLFNSARNIACAIKIGQGIKN"
     MKIVIAPDSF KESLSAEKCC QAIKAGFSTL FPDANYICLP IADGGEGTVD AMVAATGGNI        60
     VTLEVCGPMG EKVNAFYGLT GDGKTAVIEM AAASGLMLVA PEKRNPLLAS SFGTGELIRH       120
     ALDNGIRHII LGIGGSATVD GGMGMAQALG VRFLDADGQV LVANGGNLAR VASIEMDECD       180
     PRLANCHIEV ACDVDNPLVG ARGAAAVFGP QKGATPEMVE ELEQGLQNYA RVLQQQTEIN       240
     VCQMAGGGAA GGMGIAAAVF LNADIKPGIE IVLNAVNLAQ AVQGAALVIT GEGRIDSQTA       300
     GGKAPLGVAS VAKQFNVPVI GIAGVLGDGV EVVHQYGIDA VFSILPRLAP LAEVLASGET       360
     NLFNSARNIA CAIKIGQGIK N                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page