(data stored in ACNUC7421 zone)

EMBL: CP001509.GSK

CP001509.GSK         Location/Qualifiers
FT   CDS             469171..470475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsk"
FT                   /locus_tag="ECD_00428"
FT                   /product="inosine/guanosine kinase"
FT                   /EC_number="2.7.1.73"
FT                   /note="similar to b0477"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00428"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42327"
FT                   /protein_id="ACT42327.1"
FT                   /translation="MKFPGKRKSKHYFPVNARDPLLQQFQPENETSAAWVVGIDQTLVD
FT                   IEAKVDDEFIERYGLSAGHSLVIEDDVAEALYQELKQKNLITHQFAGGTIGNTMHNYSV
FT                   LADDRSVLLGVMCSNIEIGSYAYRYLCNTSSRTDLNYLQGVDGPIGRCFTLIGESGERT
FT                   FAISPGHMNQLRAESIPEDVIAGASALVLTSYLVRCKPGEPMPEATMKAIEYAKKYNVP
FT                   VVLTLGTKFVIAENPQWWQQFLKDHVSILAMNEDEAEALTGESDPLLASDKALDWVDLV
FT                   LCTAGPIGLYMAGFTEDEAKRKTQHPLLPGAIAEFNQYEFSRAMRHKDCQNPLRVYSHI
FT                   APYMGGPEKIMNTNGAGDGALAALLHDITANSYHRSNVPNSSKHKFTWLTYSSLAQVCK
FT                   YANRVSYQVLNQHSPRLTRGLPEREDSLEESYWDR"
     MKFPGKRKSK HYFPVNARDP LLQQFQPENE TSAAWVVGID QTLVDIEAKV DDEFIERYGL        60
     SAGHSLVIED DVAEALYQEL KQKNLITHQF AGGTIGNTMH NYSVLADDRS VLLGVMCSNI       120
     EIGSYAYRYL CNTSSRTDLN YLQGVDGPIG RCFTLIGESG ERTFAISPGH MNQLRAESIP       180
     EDVIAGASAL VLTSYLVRCK PGEPMPEATM KAIEYAKKYN VPVVLTLGTK FVIAENPQWW       240
     QQFLKDHVSI LAMNEDEAEA LTGESDPLLA SDKALDWVDL VLCTAGPIGL YMAGFTEDEA       300
     KRKTQHPLLP GAIAEFNQYE FSRAMRHKDC QNPLRVYSHI APYMGGPEKI MNTNGAGDGA       360
     LAALLHDITA NSYHRSNVPN SSKHKFTWLT YSSLAQVCKY ANRVSYQVLN QHSPRLTRGL       420
     PEREDSLEES YWDR                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page