(data stored in ACNUC7421 zone)

EMBL: CP001509.HOFB

CP001509.HOFB        Location/Qualifiers
FT   CDS             complement(118519..119904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofB"
FT                   /locus_tag="ECD_00106"
FT                   /product="T2SE secretion family protein; P-loop ATPase
FT                   superfamily protein"
FT                   /note="similar to b0107"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00106"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42007"
FT                   /protein_id="ACT42007.1"
FT                   /translation="MNIPQLTALCLRYHGVLLDASEEVVHVAVVDAPSHELLDALHFAT
FT                   TKRIEITCWTRQQMEGHASRTQQTLPVAVQEKHQPKAELLTRTLQSALEQRASDIHIEP
FT                   ADNAYRIRLRIDGVLHPLPDVSPDAGVALTARLKVLGNLDIAEHRLPQDGQFTVELAGN
FT                   AVSFRIATLPCRGGEKVVLRLLQQVGQALDVNTLGMQPLQLADFAHALQQPQGLVLVTG
FT                   PTGSGKTVTLYSALQKLNTADINICSVEDPVEIPIAGLNQTQIHPRAGLTFQGVLRALL
FT                   RQDPDVIMIGEIRDGETAEIAIKAAQTGHLVLSTLHTNSTCETLVRLQQMGVARWMLSS
FT                   ALTLVIAQRLVRKLCPHCRRQQGEPIHIPDNVWPSPLPHWQAPGCVHCYHGFYGRTALF
FT                   EVLPITPVIRQLISANTDVESLETHARQAGMRTLFENGCLAVEQGLTTFEELIRVLGMP
FT                   HGE"
     MNIPQLTALC LRYHGVLLDA SEEVVHVAVV DAPSHELLDA LHFATTKRIE ITCWTRQQME        60
     GHASRTQQTL PVAVQEKHQP KAELLTRTLQ SALEQRASDI HIEPADNAYR IRLRIDGVLH       120
     PLPDVSPDAG VALTARLKVL GNLDIAEHRL PQDGQFTVEL AGNAVSFRIA TLPCRGGEKV       180
     VLRLLQQVGQ ALDVNTLGMQ PLQLADFAHA LQQPQGLVLV TGPTGSGKTV TLYSALQKLN       240
     TADINICSVE DPVEIPIAGL NQTQIHPRAG LTFQGVLRAL LRQDPDVIMI GEIRDGETAE       300
     IAIKAAQTGH LVLSTLHTNS TCETLVRLQQ MGVARWMLSS ALTLVIAQRL VRKLCPHCRR       360
     QQGEPIHIPD NVWPSPLPHW QAPGCVHCYH GFYGRTALFE VLPITPVIRQ LISANTDVES       420
     LETHARQAGM RTLFENGCLA VEQGLTTFEE LIRVLGMPHG E                           461
//

If you have problems or comments...

PBIL Back to PBIL home page