(data stored in ACNUC7421 zone)

EMBL: CP001509.HOLA

CP001509.HOLA        Location/Qualifiers
FT   CDS             complement(630937..631968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="ECD_00609"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="similar to b0640"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00609"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42487"
FT                   /protein_id="ACT42487.1"
FT                   /translation="MIRLYPEQLRAQLNEGLRAAYLLLGNDPLLLQESQDAVRQVAAAQ
FT                   GFEEHHTFSIDPNTDWNAIFSLCQAMSLFASRQTLLLLLPENGPNGAINEQLLTLTGLL
FT                   HDDLLLIVRGNKLSKAQENAAWFTALANRSVQVTCQTPEQAQLPRWVAARAKQLNLELD
FT                   DAANQVLCYCYEGNLLALAQALERLSLLWPDGKLTLPRVEQAVNDAAHFTPFHWVDALL
FT                   MGKSKRALHILQQLRLEGSEPVILLRTLQRELLLLVNLKRQSAHTPLRALFDKHRVWQN
FT                   RRGMMGEALNRLSQPQLRQAVQLLTRTELTLKQDYGQSVWAELEGLSLLLCHKPLADVF
FT                   IDG"
     MIRLYPEQLR AQLNEGLRAA YLLLGNDPLL LQESQDAVRQ VAAAQGFEEH HTFSIDPNTD        60
     WNAIFSLCQA MSLFASRQTL LLLLPENGPN GAINEQLLTL TGLLHDDLLL IVRGNKLSKA       120
     QENAAWFTAL ANRSVQVTCQ TPEQAQLPRW VAARAKQLNL ELDDAANQVL CYCYEGNLLA       180
     LAQALERLSL LWPDGKLTLP RVEQAVNDAA HFTPFHWVDA LLMGKSKRAL HILQQLRLEG       240
     SEPVILLRTL QRELLLLVNL KRQSAHTPLR ALFDKHRVWQ NRRGMMGEAL NRLSQPQLRQ       300
     AVQLLTRTEL TLKQDYGQSV WAELEGLSLL LCHKPLADVF IDG                         343
//

If you have problems or comments...

PBIL Back to PBIL home page