(data stored in ACNUC7421 zone)

EMBL: CP001509.HTGA

CP001509.HTGA        Location/Qualifiers
FT   CDS             10828..11313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htgA"
FT                   /locus_tag="ECD_00012"
FT                   /product="hypothetical protein"
FT                   /note="similar to b0012"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00012"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41914"
FT                   /protein_id="ACT41914.1"
FT                   /translation="MRVNWLESKCDTPFANNLSFISSGSSSSSSFTLASTACRNSCLCS
FT                   SSIFFQVLRRNCSSNCCSISNVDISLSAFSFNRFETSSKMARYNLPCPRSLLAILSPPK
FT                   CCNSPAISCQLRRCCSGCPSIDLNSSLRISTLERRVLPFSLWVSNRAKFANCSSLQC"
     MRVNWLESKC DTPFANNLSF ISSGSSSSSS FTLASTACRN SCLCSSSIFF QVLRRNCSSN        60
     CCSISNVDIS LSAFSFNRFE TSSKMARYNL PCPRSLLAIL SPPKCCNSPA ISCQLRRCCS       120
     GCPSIDLNSS LRISTLERRV LPFSLWVSNR AKFANCSSLQ C                           161
//

If you have problems or comments...

PBIL Back to PBIL home page