(data stored in ACNUC7421 zone)

EMBL: CP001509.HTRE

CP001509.HTRE        Location/Qualifiers
FT   CDS             complement(155671..158271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrE"
FT                   /locus_tag="ECD_00138"
FT                   /product="putative outer membrane usher protein"
FT                   /note="similar to b0139"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00138"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42039"
FT                   /protein_id="ACT42039.1"
FT                   /translation="MTIKPTKNYHNHLTRIATFCALLYCNSAFCAELVEYDHTFLMGQN
FT                   ASNIDLSRYSEGNPAIPGMYDLSVYVNDQPIINQSITFIEIEGKKNAQACITLKNLLQF
FT                   HINSPDINNEKAVLLARDETLGNCLNLTKIIPQASVRYDVNEQRLDIDVPQAWVMKNYQ
FT                   NYVDPSLWENGINAAMLSYNLNGYHSETPGRRNDSIYAAFNGGMNLGAWRLRASGNYNW
FT                   MTDSGSNYDFKNRYIQRDIASLRSQLILGESYTTGETFDSVSIRGIRLYSDSRMLPPTL
FT                   ASFAPIIHGVANTNAKVTITQGGYKIYETTVPPGAFVIDDLSPSGYGSDLIVTVEESDG
FT                   SKRTFSQPFSSVVQMLRPGVGRWDISGGQVLKDDIQDEPNLFQASYYYGLNNYLTGYTG
FT                   IQITDNNYTAGLLGLGLNTSVGAFSFDVTHSNVRIPDDKTYQGQSYRVSWNKLFEETST
FT                   SLNIAAYRYSTQNYLGLNDALTLIDEVKHPEQDLEPKSMRNYSRMKNQVTVSINQPLKF
FT                   EKKDYGSFYLSGSWSDYWASGQNRSNYSIGYSNSASWGSYSVSAQRSWNEDGDTDDSVY
FT                   LSFTIPIEKLLGTEQRTSGFQSIDTQMSSDFKGNNQLNVSSSGYSDNARVSYSVNTGYT
FT                   MNKASKDLSYVGGYASYESPWGTLAGSVSANSDNSRQVSLSTDGGFVLHSGGLTFSNDS
FT                   FSDSDTLAVVQAPGAQGARINYGNSTIDRWGYGVTSALSPYHENRIALDINDLENDVEL
FT                   KSTSAVAVPRQGSVVFADFETVQGQSAIMNITRSDGKNIPFAADIYDEQGNVIGNVGQG
FT                   GQAFVRGIEQQGNISIKWLEESKPVSCLAHYQQSSEAEKIAQSIILNGIRCQIQ"
     MTIKPTKNYH NHLTRIATFC ALLYCNSAFC AELVEYDHTF LMGQNASNID LSRYSEGNPA        60
     IPGMYDLSVY VNDQPIINQS ITFIEIEGKK NAQACITLKN LLQFHINSPD INNEKAVLLA       120
     RDETLGNCLN LTKIIPQASV RYDVNEQRLD IDVPQAWVMK NYQNYVDPSL WENGINAAML       180
     SYNLNGYHSE TPGRRNDSIY AAFNGGMNLG AWRLRASGNY NWMTDSGSNY DFKNRYIQRD       240
     IASLRSQLIL GESYTTGETF DSVSIRGIRL YSDSRMLPPT LASFAPIIHG VANTNAKVTI       300
     TQGGYKIYET TVPPGAFVID DLSPSGYGSD LIVTVEESDG SKRTFSQPFS SVVQMLRPGV       360
     GRWDISGGQV LKDDIQDEPN LFQASYYYGL NNYLTGYTGI QITDNNYTAG LLGLGLNTSV       420
     GAFSFDVTHS NVRIPDDKTY QGQSYRVSWN KLFEETSTSL NIAAYRYSTQ NYLGLNDALT       480
     LIDEVKHPEQ DLEPKSMRNY SRMKNQVTVS INQPLKFEKK DYGSFYLSGS WSDYWASGQN       540
     RSNYSIGYSN SASWGSYSVS AQRSWNEDGD TDDSVYLSFT IPIEKLLGTE QRTSGFQSID       600
     TQMSSDFKGN NQLNVSSSGY SDNARVSYSV NTGYTMNKAS KDLSYVGGYA SYESPWGTLA       660
     GSVSANSDNS RQVSLSTDGG FVLHSGGLTF SNDSFSDSDT LAVVQAPGAQ GARINYGNST       720
     IDRWGYGVTS ALSPYHENRI ALDINDLEND VELKSTSAVA VPRQGSVVFA DFETVQGQSA       780
     IMNITRSDGK NIPFAADIYD EQGNVIGNVG QGGQAFVRGI EQQGNISIKW LEESKPVSCL       840
     AHYQQSSEAE KIAQSIILNG IRCQIQ                                            866
//

If you have problems or comments...

PBIL Back to PBIL home page