(data stored in ACNUC7421 zone)

EMBL: CP001509.ILVH

CP001509.ILVH        Location/Qualifiers
FT   CDS             90162..90653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="ECD_00080"
FT                   /product="acetolactate synthase 3, small subunit,
FT                   valine-sensitive"
FT                   /EC_number="2.2.1.6"
FT                   /note="similar to b0078"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41981"
FT                   /protein_id="ACT41981.1"
FT                   /translation="MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSR
FT                   MTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRN
FT                   TEIFRGQIIDVTPSLYTVQLAGTSGKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIMR
FT                   "
     MRRILSVLLE NESGALSRVI GLFSQRGYNI ESLTVAPTDD PTLSRMTIQT VGDEKVLEQI        60
     EKQLHKLVDV LRVSELGQGA HVEREIMLVK IQASGYGRDE VKRNTEIFRG QIIDVTPSLY       120
     TVQLAGTSGK LDAFLASIRD VAKIVEVARS GVVGLSRGDK IMR                         163
//

If you have problems or comments...

PBIL Back to PBIL home page