(data stored in ACNUC7421 zone)

EMBL: CP001509.INSB-5

CP001509.INSB-5      Location/Qualifiers
FT   CDS             complement(373743..374246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB-5"
FT                   /locus_tag="ECD_00340"
FT                   /product="IS1 protein InsB"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42239"
FT                   /protein_id="ACT42239.1"
FT                   /translation="MPGNCPHYGRWPQHDFTSLKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   QWGYVGAKSRQRWLFYAYDRLRKTVVAHVFGERTMATLGRLMSLMSPFDVVIWMTDGWP
FT                   LYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
     MPGNCPHYGR WPQHDFTSLK KLRPQSVTSR IQPGSDVIVC AEMDEQWGYV GAKSRQRWLF        60
     YAYDRLRKTV VAHVFGERTM ATLGRLMSLM SPFDVVIWMT DGWPLYESRL KGKLHVISKR       120
     YTQRIERHNL NLRQHLARLG RKSLSFSKSV ELHDKVIGHY LNIKHYQ                     167
//

If you have problems or comments...

PBIL Back to PBIL home page