(data stored in ACNUC7421 zone)

EMBL: CP001509.INSJ-2

CP001509.INSJ-2      Location/Qualifiers
FT   CDS             642514..643035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insJ-2"
FT                   /locus_tag="ECD_00619"
FT                   /product="IS150 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00619"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42495"
FT                   /protein_id="ACT42495.1"
FT                   /translation="MSKPKYPFEKRLEVVNHYFTTDDGYRIISARFGVPRTQVRTWVAL
FT                   YEKHGEKGLIPKPKGVSADPELRIKVVKAVIEQHMSLNQAAAHFMLAGSGSVARWLKVY
FT                   EERGEAGLRALKIGTKRNIAISVDPEKAASALELSKDRRIEDLERQVRFLETRLMYLKK
FT                   LKALAHPTKK"
     MSKPKYPFEK RLEVVNHYFT TDDGYRIISA RFGVPRTQVR TWVALYEKHG EKGLIPKPKG        60
     VSADPELRIK VVKAVIEQHM SLNQAAAHFM LAGSGSVARW LKVYEERGEA GLRALKIGTK       120
     RNIAISVDPE KAASALELSK DRRIEDLERQ VRFLETRLMY LKKLKALAHP TKK              173
//

If you have problems or comments...

PBIL Back to PBIL home page