(data stored in ACNUC7421 zone)

EMBL: CP001509.INSL-3

CP001509.INSL-3      Location/Qualifiers
FT   CDS             568551..569663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insL-3"
FT                   /locus_tag="ECD_00548"
FT                   /product="IS186 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00548"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42427"
FT                   /protein_id="ACT42427.1"
FT                   /translation="MNYSHDNWSAILAHIGKPEELDTSARNAGALTRRREIRDAATLLR
FT                   LGLAYGPGGMSLREVTAWAQLHDVATLSDVALLKRLRNAADWFGILAAQTLAVRAAVTG
FT                   CTSGKRLRLVDGTAISAPGGGSAEWRLHMGYDPHTCQFTDFELTDSRDAERLDRFAQTA
FT                   DEIRIADRGFGSRPECIRSLAFGEADYIVRVHWRGLRWLTAEGMRFDMMGFLRGLDCGK
FT                   NGETTVMIGNSGNKKAGAPFPARLIAVSLPPEKALISKTRLLSENRRKGRVVQAETLEA
FT                   AGHVLLLTSLPEDEYSAEQVADCYRLRWQIELAFKRLKSLLHLDALRAKEPELAKAWIF
FT                   ANLLAAFLIDDIIQPSLDFPPRSAGSEKKN"
     MNYSHDNWSA ILAHIGKPEE LDTSARNAGA LTRRREIRDA ATLLRLGLAY GPGGMSLREV        60
     TAWAQLHDVA TLSDVALLKR LRNAADWFGI LAAQTLAVRA AVTGCTSGKR LRLVDGTAIS       120
     APGGGSAEWR LHMGYDPHTC QFTDFELTDS RDAERLDRFA QTADEIRIAD RGFGSRPECI       180
     RSLAFGEADY IVRVHWRGLR WLTAEGMRFD MMGFLRGLDC GKNGETTVMI GNSGNKKAGA       240
     PFPARLIAVS LPPEKALISK TRLLSENRRK GRVVQAETLE AAGHVLLLTS LPEDEYSAEQ       300
     VADCYRLRWQ IELAFKRLKS LLHLDALRAK EPELAKAWIF ANLLAAFLID DIIQPSLDFP       360
     PRSAGSEKKN                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page