(data stored in ACNUC7421 zone)

EMBL: CP001509.IRAP

CP001509.IRAP        Location/Qualifiers
FT   CDS             366011..366271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iraP"
FT                   /locus_tag="ECD_00329"
FT                   /product="anti-RssB factor, RpoS stabilzer during Pi
FT                   starvation; anti-adapter protein"
FT                   /note="similar to b0382"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00329"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42228"
FT                   /protein_id="ACT42228.1"
FT                   /translation="MKNLIAELLFKLAQKEEESKELCAQVEALEIIVTAMLRNMAQNDQ
FT                   QRLIDQVEGALYEVKPDASIPDDDTELLRDYVKKLLKHPRQ"
     MKNLIAELLF KLAQKEEESK ELCAQVEALE IIVTAMLRNM AQNDQQRLID QVEGALYEVK        60
     PDASIPDDDT ELLRDYVKKL LKHPRQ                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page