(data stored in ACNUC7421 zone)

EMBL: CP001509.KDPA

CP001509.KDPA        Location/Qualifiers
FT   CDS             complement(686933..688606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="ECD_00655"
FT                   /product="potassium translocating ATPase, subunit A"
FT                   /EC_number="3.6.3.9"
FT                   /note="similar to b0698"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00655"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42531"
FT                   /protein_id="ACT42531.1"
FT                   /translation="MAAQGFLLIATFLLVLMVLARPLGSGLARLINDIPLPGTTGVERV
FT                   LFRALGVSDREMNWKQYLCAILGLNMLGLAVLFFMLLGQHYLPLNPQQLPGLSWDLALN
FT                   TAVSFVTNTNWQSYSGETTLSYFSQMAGLTVQNFLSAASGIAVIFALIRAFTRQSMSTL
FT                   GNAWVDLLRITLWVLVPVALLIALFFIQQGALQNFLPYQAVNTVEGAQQLLPMGPVASQ
FT                   EAIKMLGTNGGGFFNANSSHPFENPTALTNFVQMLAIFLIPTALCFAFGEVTGDRRQGR
FT                   MLLWAMSVIFVICVGVVMWAEVQGNPHLLALGTDSSINMEGKESRFGVLVSSLFAVVTT
FT                   AASCGAVIAMHDSFTALGGMVPMWLMQIGEVVFGGVGSGLYGMMLFVLLAVFIAGLMIG
FT                   RTPEYLGKKIDVREMKLTALAILVTPTLVLMGAALAMMTDAGRSAMLNPGPHGFSEVLY
FT                   AVSSAANNNGSAFAGLSANSPFWNCLLAFCMFVGRFGVIIPVMAIAGSLVSKKSQAASS
FT                   GTLPTHGPLFVGLLIGTVLLVGALTFIPALALGPVAEYLS"
     MAAQGFLLIA TFLLVLMVLA RPLGSGLARL INDIPLPGTT GVERVLFRAL GVSDREMNWK        60
     QYLCAILGLN MLGLAVLFFM LLGQHYLPLN PQQLPGLSWD LALNTAVSFV TNTNWQSYSG       120
     ETTLSYFSQM AGLTVQNFLS AASGIAVIFA LIRAFTRQSM STLGNAWVDL LRITLWVLVP       180
     VALLIALFFI QQGALQNFLP YQAVNTVEGA QQLLPMGPVA SQEAIKMLGT NGGGFFNANS       240
     SHPFENPTAL TNFVQMLAIF LIPTALCFAF GEVTGDRRQG RMLLWAMSVI FVICVGVVMW       300
     AEVQGNPHLL ALGTDSSINM EGKESRFGVL VSSLFAVVTT AASCGAVIAM HDSFTALGGM       360
     VPMWLMQIGE VVFGGVGSGL YGMMLFVLLA VFIAGLMIGR TPEYLGKKID VREMKLTALA       420
     ILVTPTLVLM GAALAMMTDA GRSAMLNPGP HGFSEVLYAV SSAANNNGSA FAGLSANSPF       480
     WNCLLAFCMF VGRFGVIIPV MAIAGSLVSK KSQAASSGTL PTHGPLFVGL LIGTVLLVGA       540
     LTFIPALALG PVAEYLS                                                      557
//

If you have problems or comments...

PBIL Back to PBIL home page