(data stored in ACNUC7421 zone)

EMBL: CP001509.KDPC

CP001509.KDPC        Location/Qualifiers
FT   CDS             complement(684281..684853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="ECD_00653"
FT                   /product="potassium translocating ATPase, subunit C"
FT                   /EC_number="3.6.3.9"
FT                   /note="similar to b0696"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00653"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42529"
FT                   /protein_id="ACT42529.1"
FT                   /translation="MRGLRPALSTFIFLLLITGGVYPLLTTVLGQWWFPWQANGSLIRE
FT                   GDTVRGSALIGQNFTGNGYFQGRPSATAEMPYNPQASGGSNLAVSNPELDKQIAARVAA
FT                   LRAANPDASTNVPVELVTASASGLDNNITPQAAVWQIPRVAKARNLSVEQLTQLIAKYS
FT                   QQPLVKYIGQPVVNIVELNLALDKLDE"
     MRGLRPALST FIFLLLITGG VYPLLTTVLG QWWFPWQANG SLIREGDTVR GSALIGQNFT        60
     GNGYFQGRPS ATAEMPYNPQ ASGGSNLAVS NPELDKQIAA RVAALRAANP DASTNVPVEL       120
     VTASASGLDN NITPQAAVWQ IPRVAKARNL SVEQLTQLIA KYSQQPLVKY IGQPVVNIVE       180
     LNLALDKLDE                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page