(data stored in ACNUC7421 zone)

EMBL: CP001509.LEUD

CP001509.LEUD        Location/Qualifiers
FT   CDS             complement(81653..82258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="ECD_00073"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="similar to b0071"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00073"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41974"
FT                   /protein_id="ACT41974.1"
FT                   /translation="MAEKFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFN
FT                   DWRFLDEKGQQPNPDFVLNFPQYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAP
FT                   SFADIFYGNSFNNQLLPVKLSDAEVDELFALVKANPGIHFDVDLEAQEVKAGEKTYRFT
FT                   IDAFRRHCMMNGLDSIGLTLQHDDAIAAYEAKQPAFMN"
     MAEKFIKHTG LVVPLDAANV DTDAIIPKQF LQKVTRTGFG AHLFNDWRFL DEKGQQPNPD        60
     FVLNFPQYQG ASILLARENF GCGSSREHAP WALTDYGFKV VIAPSFADIF YGNSFNNQLL       120
     PVKLSDAEVD ELFALVKANP GIHFDVDLEA QEVKAGEKTY RFTIDAFRRH CMMNGLDSIG       180
     LTLQHDDAIA AYEAKQPAFM N                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page