(data stored in ACNUC7421 zone)

EMBL: CP001509.LIPB

CP001509.LIPB        Location/Qualifiers
FT   CDS             complement(621999..622640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="ECD_00599"
FT                   /product="octanoyltransferase; octanoyl-[ACP]:protein
FT                   N-octanoyltransferase"
FT                   /note="similar to b0630"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00599"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42477"
FT                   /protein_id="ACT42477.1"
FT                   /translation="MYQDKILVRQLGLQPYEPISQAMHEFTDTRDDSTLDEIWLVEHYP
FT                   VFTQGQAGKAEHILMPGDIPVIQSDRGGQVTYHGPGQQVMYVLLNLKRRKLGVRELVTL
FT                   LEQTVVNTLAELGIEAHPRADAPGVYVGEKKICSLGLRIRRGCSFHGLALNVNMDLSPF
FT                   LRINPCGYAGMEMAKISQWKPEATTNNIAPRLLENILALLNNPDFEYITA"
     MYQDKILVRQ LGLQPYEPIS QAMHEFTDTR DDSTLDEIWL VEHYPVFTQG QAGKAEHILM        60
     PGDIPVIQSD RGGQVTYHGP GQQVMYVLLN LKRRKLGVRE LVTLLEQTVV NTLAELGIEA       120
     HPRADAPGVY VGEKKICSLG LRIRRGCSFH GLALNVNMDL SPFLRINPCG YAGMEMAKIS       180
     QWKPEATTNN IAPRLLENIL ALLNNPDFEY ITA                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page