(data stored in ACNUC7421 zone)

EMBL: CP001509.METI

CP001509.METI        Location/Qualifiers
FT   CDS             complement(223809..224462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metI"
FT                   /locus_tag="ECD_00197"
FT                   /product="DL-methionine transporter subunit"
FT                   /note="similar to b0198"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00197"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42098"
FT                   /protein_id="ACT42098.1"
FT                   /translation="MSEPMMWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQ
FT                   IIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFI
FT                   ARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAM
FT                   GGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVILVYLIQFAGDRIVRAVTRK"
     MSEPMMWLLV RGVWETLAMT FVSGFFGFVI GLPVGVLLYV TRPGQIIANA KLYRTVSAIV        60
     NIFRSIPFII LLVWMIPFTR VIVGTSIGLQ AAIVPLTVGA APFIARMVEN ALLEIPTGLI       120
     EASRAMGATP MQIVRKVLLP EALPGLVNAA TITLITLVGY SAMGGAVGAG GLGQIGYQYG       180
     YIGYNATVMN TVLVLLVILV YLIQFAGDRI VRAVTRK                                217
//

If you have problems or comments...

PBIL Back to PBIL home page