(data stored in ACNUC7421 zone)

EMBL: CP001509.METQ

CP001509.METQ        Location/Qualifiers
FT   CDS             complement(222954..223769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ"
FT                   /locus_tag="ECD_00196"
FT                   /product="DL-methionine transporter subunit"
FT                   /note="similar to b0197"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00196"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42097"
FT                   /protein_id="ACT42097.1"
FT                   /translation="MAFKFKTFAAVGALIGSLALVGCGQDEKDPNHIKVGVIVGAEQQV
FT                   AEVAQKVAKDKYGLDVELVTFNDYVLPNEALSKGDIDANAFQHKPYLDQQLKDRGYKLV
FT                   AVGNTFVYPIAGYSKKIKSLDELQDGSQVAVPNDPTNLGRSLLLLQKVGLIKLKDGVGL
FT                   LPTVLDVVENPKNLKIVELEAPQLPRSLDDAQIALAVINTTYASQIGLTPAKDGIFVED
FT                   KDSPYVNLIVTREDNKDAENVKKFVQAYQSDEVYEAANKVFNGGAVKGW"
     MAFKFKTFAA VGALIGSLAL VGCGQDEKDP NHIKVGVIVG AEQQVAEVAQ KVAKDKYGLD        60
     VELVTFNDYV LPNEALSKGD IDANAFQHKP YLDQQLKDRG YKLVAVGNTF VYPIAGYSKK       120
     IKSLDELQDG SQVAVPNDPT NLGRSLLLLQ KVGLIKLKDG VGLLPTVLDV VENPKNLKIV       180
     ELEAPQLPRS LDDAQIALAV INTTYASQIG LTPAKDGIFV EDKDSPYVNL IVTREDNKDA       240
     ENVKKFVQAY QSDEVYEAAN KVFNGGAVKG W                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page