(data stored in ACNUC7421 zone)

EMBL: CP001509.MOAA

CP001509.MOAA        Location/Qualifiers
FT   CDS             801037..802026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaA"
FT                   /locus_tag="ECD_00748"
FT                   /product="molybdopterin biosynthesis protein A"
FT                   /note="similar to b0781"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00748"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42649"
FT                   /protein_id="ACT42649.1"
FT                   /translation="MASQLTDAFARKFYYLRLSITDVCNFRCTYCLPDGYKPSGVTNKG
FT                   FLTVDEIRRVTRAFASLGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQIAVTTNGYR
FT                   LERDVANWRDAGLTGINVSVDSLDARQFHAITGQDKFNQVMAGIDAAFEAGFEKVKVNT
FT                   VLMRDVNHHQLDTFLNWIQHRPIQLRFIELMETGEGSELFRKHHISGQVLRDELLRRGW
FT                   IHQLRQRSDGPAQVFCHPDYAGEIGLIMPYEKDFCATCNRLRVSSIGKLHLCLFGEGGV
FT                   NLRDLLEDDTQQQALEARISAALREKKQTHFLHQNNTGITQNLSYIGG"
     MASQLTDAFA RKFYYLRLSI TDVCNFRCTY CLPDGYKPSG VTNKGFLTVD EIRRVTRAFA        60
     SLGTEKVRLT GGEPSLRRDF TDIIAAVREN DAIRQIAVTT NGYRLERDVA NWRDAGLTGI       120
     NVSVDSLDAR QFHAITGQDK FNQVMAGIDA AFEAGFEKVK VNTVLMRDVN HHQLDTFLNW       180
     IQHRPIQLRF IELMETGEGS ELFRKHHISG QVLRDELLRR GWIHQLRQRS DGPAQVFCHP       240
     DYAGEIGLIM PYEKDFCATC NRLRVSSIGK LHLCLFGEGG VNLRDLLEDD TQQQALEARI       300
     SAALREKKQT HFLHQNNTGI TQNLSYIGG                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page