(data stored in ACNUC7421 zone)

EMBL: CP001509.MOAC

CP001509.MOAC        Location/Qualifiers
FT   CDS             802563..803048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="ECD_00750"
FT                   /product="molybdopterin biosynthesis, protein C"
FT                   /note="similar to b0783"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00750"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42651"
FT                   /protein_id="ACT42651.1"
FT                   /translation="MSQLTHINAAGEAHMVDVSAKAETVREARAEAFVTMRSETLAMII
FT                   DGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLMLSKVEVNLQAEPEHNRVRIETLCR
FT                   LTGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLAKSGGKSGDFKVEADD"
     MSQLTHINAA GEAHMVDVSA KAETVREARA EAFVTMRSET LAMIIDGRHH KGDVFATARI        60
     AGIQAAKRTW DLIPLCHPLM LSKVEVNLQA EPEHNRVRIE TLCRLTGKTG VEMEALTAAS       120
     VAALTIYDMC KAVQKDMVIG PVRLLAKSGG KSGDFKVEAD D                           161
//

If you have problems or comments...

PBIL Back to PBIL home page