(data stored in ACNUC7421 zone)

EMBL: CP001509.MOAE

CP001509.MOAE        Location/Qualifiers
FT   CDS             803288..803740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaE"
FT                   /locus_tag="ECD_00752"
FT                   /product="molybdopterin synthase, large subunit"
FT                   /note="similar to b0785"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00752"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42653"
FT                   /protein_id="ACT42653.1"
FT                   /translation="MAETKIVVGPQPFSVGEEYPWLAERDEDGAVVTFTGKVRNHNLGD
FT                   SVKALTLEHYPGMTEKALAEIVDEARNRWPLGRVTVIHRIGELWPGDEIVFVGVTSEHR
FT                   SSAFEAGQFIMDYLKTRAPFWKREATPEGDRWVEARESDQQAAKRW"
     MAETKIVVGP QPFSVGEEYP WLAERDEDGA VVTFTGKVRN HNLGDSVKAL TLEHYPGMTE        60
     KALAEIVDEA RNRWPLGRVT VIHRIGELWP GDEIVFVGVT SEHRSSAFEA GQFIMDYLKT       120
     RAPFWKREAT PEGDRWVEAR ESDQQAAKRW                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page