(data stored in ACNUC7421 zone)

EMBL: CP001509.MRDA

CP001509.MRDA        Location/Qualifiers
FT   CDS             complement(626679..628580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdA"
FT                   /locus_tag="ECD_00604"
FT                   /product="penicillin-binding protein 2, transpeptidase
FT                   involved in peptidoglycan synthesis"
FT                   /note="similar to b0635"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00604"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42482"
FT                   /protein_id="ACT42482.1"
FT                   /translation="MKLQNSFRDYTAESALFVRRALVAFLGILLLTGVLIANLYNLQIV
FT                   RFTDYQTRSNENRIKLVPIAPSRGIIYDRNGIPLALNRTIYQIEMMPEKVDNVQQTLDA
FT                   LRSVVDLTDDDIAAFRKERARSHRFTSIPVKTNLTEVQVARFAVNQYRFPGVEVKGYKR
FT                   RYYPYGSALTHVIGYVSKINDKDVERLNNDGKLANYAATHDIGKLGIERYYEDVLHGQT
FT                   GYEEVEVNNRGRVIRQLKEVPPQAGHDIYLTLDLKLQQYIETLLAGSRAAVVVTDPRTG
FT                   GVLALVSTPSYDPNLFVDGISSKDYSALLNDPNTPLVNRATQGVYPPASTVKPYVAVSA
FT                   LSAGVITRNTTLFDPGWWQLPGSEKRYRDWKKWGHGRLNVTRSLEESADTFFYQVAYDM
FT                   GIDRLSEWMGKFGYGHYTGIDLAEERSGNMPTREWKQKRFKKPWYQGDTIPVGIGQGYW
FT                   TATPIQMSKALMILINDGIVKVPHLLMSTAEDGKQVPWVQPHEPPVGDIHSGYWELAKD
FT                   GMYGVANRPNGTAHKYFASAPYKIAAKSGTAQVFGLKANETYNAHKIAERLRDHKLMTA
FT                   FAPYNNPQVAVAMILENGGAGPAVGTLMRQILDHIMLGDNNTDLPAENPAVAAAEDH"
     MKLQNSFRDY TAESALFVRR ALVAFLGILL LTGVLIANLY NLQIVRFTDY QTRSNENRIK        60
     LVPIAPSRGI IYDRNGIPLA LNRTIYQIEM MPEKVDNVQQ TLDALRSVVD LTDDDIAAFR       120
     KERARSHRFT SIPVKTNLTE VQVARFAVNQ YRFPGVEVKG YKRRYYPYGS ALTHVIGYVS       180
     KINDKDVERL NNDGKLANYA ATHDIGKLGI ERYYEDVLHG QTGYEEVEVN NRGRVIRQLK       240
     EVPPQAGHDI YLTLDLKLQQ YIETLLAGSR AAVVVTDPRT GGVLALVSTP SYDPNLFVDG       300
     ISSKDYSALL NDPNTPLVNR ATQGVYPPAS TVKPYVAVSA LSAGVITRNT TLFDPGWWQL       360
     PGSEKRYRDW KKWGHGRLNV TRSLEESADT FFYQVAYDMG IDRLSEWMGK FGYGHYTGID       420
     LAEERSGNMP TREWKQKRFK KPWYQGDTIP VGIGQGYWTA TPIQMSKALM ILINDGIVKV       480
     PHLLMSTAED GKQVPWVQPH EPPVGDIHSG YWELAKDGMY GVANRPNGTA HKYFASAPYK       540
     IAAKSGTAQV FGLKANETYN AHKIAERLRD HKLMTAFAPY NNPQVAVAMI LENGGAGPAV       600
     GTLMRQILDH IMLGDNNTDL PAENPAVAAA EDH                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page