(data stored in ACNUC7421 zone)

EMBL: CP001509.N

CP001509.N           Location/Qualifiers
FT   CDS             complement(759487..759786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="N"
FT                   /locus_tag="ECD_10020"
FT                   /product="putative regulatory protein N (early gene
FT                   regulator)"
FT                   /note="similar to lambdap49; distantly related"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10020"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42602"
FT                   /protein_id="ACT42602.1"
FT                   /translation="MVTIVWKESKGTAKSRYKARRAELIAERRSNEALARKIALKLSGC
FT                   VRADKAASLGSLRCKKAEEVERKQNRIYYSKPRSEMGVTCVGRQKIKLGSKPLI"
     MVTIVWKESK GTAKSRYKAR RAELIAERRS NEALARKIAL KLSGCVRADK AASLGSLRCK        60
     KAEEVERKQN RIYYSKPRSE MGVTCVGRQK IKLGSKPLI                               99
//

If you have problems or comments...

PBIL Back to PBIL home page