(data stored in ACNUC7421 zone)

EMBL: CP001509.NADA

CP001509.NADA        Location/Qualifiers
FT   CDS             740493..741536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /locus_tag="ECD_00703"
FT                   /product="quinolinate synthase, subunit A"
FT                   /note="similar to b0750"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00703"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42578"
FT                   /protein_id="ACT42578.1"
FT                   /translation="MSVMFDPDTAIYPFPPKPTPLSIDEKAYYREKIKRLLKERNAVMV
FT                   AHYYTDPEIQQLAEETGGCISDSLEMARFGAKHPASTLLVAGVRFMGETAKILSPEKTI
FT                   LMPTLQAECSLDLGCPVEEFNAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
FT                   DHLDSLGEKIIWAPDKHLGRYVQKQTGGDILCWQGACIVHDEFKTQALTRLQEEYPDAA
FT                   ILVHPESPQAIVDMADAVGSTSQLIAAAKTLPHQRLIVATDRGIFYKMQQAVPDKELLE
FT                   APTAGEGATCRSCAHCPWMAMNGLQAIAEALEQEGSNHEVHVDERLRERALVPLNRMLD
FT                   FAATLRG"
     MSVMFDPDTA IYPFPPKPTP LSIDEKAYYR EKIKRLLKER NAVMVAHYYT DPEIQQLAEE        60
     TGGCISDSLE MARFGAKHPA STLLVAGVRF MGETAKILSP EKTILMPTLQ AECSLDLGCP       120
     VEEFNAFCDA HPDRTVVVYA NTSAAVKARA DWVVTSSIAV ELIDHLDSLG EKIIWAPDKH       180
     LGRYVQKQTG GDILCWQGAC IVHDEFKTQA LTRLQEEYPD AAILVHPESP QAIVDMADAV       240
     GSTSQLIAAA KTLPHQRLIV ATDRGIFYKM QQAVPDKELL EAPTAGEGAT CRSCAHCPWM       300
     AMNGLQAIAE ALEQEGSNHE VHVDERLRER ALVPLNRMLD FAATLRG                     347
//

If you have problems or comments...

PBIL Back to PBIL home page