(data stored in ACNUC7421 zone)

EMBL: CP001509.NAGE

CP001509.NAGE        Location/Qualifiers
FT   CDS             663818..665764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagE"
FT                   /locus_tag="ECD_00636"
FT                   /product="N-acetyl glucosamine specific PTS enzyme IIC,
FT                   IIB, and IIA components"
FT                   /EC_number="2.7.1.191"
FT                   /note="similar to b0679"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00636"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42512"
FT                   /protein_id="ACT42512.1"
FT                   /translation="MNILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVAFIAQAG
FT                   GAIFDNLALIFAIGVASSWSKDSAGAAALAGAVGYFVLTKAMVTINPEINMGVLAGIIT
FT                   GLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGG
FT                   EWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTVFHGDINRFYAG
FT                   DGTAGMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLE
FT                   FLFMFLAPLLYLLHALLTGISLFVATLLGIHAGFSFSAGAIDYALMYNLPAASQNVWML
FT                   LVMGVVFFAIYFVVFSLVIRMFNLKTPGREDKEDEIVTEEANSNTEEGLTQLATNYIAA
FT                   VGGTDNLKAIDACITRLRLTVVDSARVNDAMCKRLGASGVVKLNKQTIQVIVGAKAESI
FT                   GDAMKKVVARGPVAAASAEATPATAAPVAKPQAVPNAVSIAELVSPITGDVVALDQVPD
FT                   EAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVA
FT                   LEGKGFKRLVEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSNIDDFSGLIIKAQGH
FT                   VVAGQTPLYEIKK"
     MNILGFFQRL GRALQLPIAV LPVAALLLRF GQPDLLNVAF IAQAGGAIFD NLALIFAIGV        60
     ASSWSKDSAG AAALAGAVGY FVLTKAMVTI NPEINMGVLA GIITGLVGGA AYNRWSDIKL       120
     PDFLSFFGGK RFVPIATGFF CLVLAAIFGY VWPPVQHAIH AGGEWIVSAG ALGSGIFGFI       180
     NRLLIPTGLH QVLNTIAWFQ IGEFTNAAGT VFHGDINRFY AGDGTAGMFM SGFFPIMMFG       240
     LPGAALAMYF AAPKERRPMV GGMLLSVAVT AFLTGVTEPL EFLFMFLAPL LYLLHALLTG       300
     ISLFVATLLG IHAGFSFSAG AIDYALMYNL PAASQNVWML LVMGVVFFAI YFVVFSLVIR       360
     MFNLKTPGRE DKEDEIVTEE ANSNTEEGLT QLATNYIAAV GGTDNLKAID ACITRLRLTV       420
     VDSARVNDAM CKRLGASGVV KLNKQTIQVI VGAKAESIGD AMKKVVARGP VAAASAEATP       480
     ATAAPVAKPQ AVPNAVSIAE LVSPITGDVV ALDQVPDEAF ASKAVGDGVA VKPTDKIVVS       540
     PAAGTIVKIF NTNHAFCLET EKGAEIVVHM GIDTVALEGK GFKRLVEEGA QVSAGQPILE       600
     MDLDYLNANA RSMISPVVCS NIDDFSGLII KAQGHVVAGQ TPLYEIKK                    648
//

If you have problems or comments...

PBIL Back to PBIL home page