(data stored in ACNUC7421 zone)

EMBL: CP001509.NINE

CP001509.NINE        Location/Qualifiers
FT   CDS             541516..541686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ninE"
FT                   /locus_tag="ECD_00498"
FT                   /product="DLP12 prophage; conserved protein"
FT                   /note="similar to b0548"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00498"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42396"
FT                   /protein_id="ACT42396.1"
FT                   /translation="MATPLIRVMNGHIYKVPNRRKRKPELKPSEIPTLLGYTASLVDKK
FT                   WLRLAARRNHG"
     MATPLIRVMN GHIYKVPNRR KRKPELKPSE IPTLLGYTAS LVDKKWLRLA ARRNHG            56
//

If you have problems or comments...

PBIL Back to PBIL home page