(data stored in ACNUC7421 zone)

EMBL: CP001509.NOHD

CP001509.NOHD        Location/Qualifiers
FT   CDS             548011..548586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nohD"
FT                   /locus_tag="ECD_00511"
FT                   /product="DLP12 prophage; DNA packaging protein"
FT                   /note="similar to b0560"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00511"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42408"
FT                   /protein_id="ACT42408.1"
FT                   /translation="MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAA
FT                   VIRWYAERDAEIENEKLRREVEELRQASETDLQPGTIEYERHRLTRAQADAQELKNARD
FT                   SAEVVETAFCTFVLSRIAGEIASILDGIPLSVQRRFPELENRHVDFLKRDIIKAMNKAA
FT                   ALDELIPEHGTGRRAGGLGAVRQPAGEP"
     MEVNKKQLAD IFGASIRTIQ NWQEQGMPVL RGGGKGNEVL YDSAAVIRWY AERDAEIENE        60
     KLRREVEELR QASETDLQPG TIEYERHRLT RAQADAQELK NARDSAEVVE TAFCTFVLSR       120
     IAGEIASILD GIPLSVQRRF PELENRHVDF LKRDIIKAMN KAAALDELIP EHGTGRRAGG       180
     LGAVRQPAGE P                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page