(data stored in ACNUC7421 zone)

EMBL: CP001509.NU1

CP001509.NU1         Location/Qualifiers
FT   CDS             768665..769210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nu1"
FT                   /locus_tag="ECD_10035"
FT                   /product="DNA packaging protein"
FT                   /note="similar to lambdap01"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10035"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42617"
FT                   /protein_id="ACT42617.1"
FT                   /translation="MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAA
FT                   VIKWYAERDAEIENEKLRREVEELRQASEADLQPGTIEYERHRLTRAQADAQELKNARD
FT                   SAEVVETAFCTFVLSRIAGEIASILDGLPLSVQRRFPELENRHVDFLKRDIIKAMNKAA
FT                   ALDELIPGLLSEYIEQSG"
     MEVNKKQLAD IFGASIRTIQ NWQEQGMPVL RGGGKGNEVL YDSAAVIKWY AERDAEIENE        60
     KLRREVEELR QASEADLQPG TIEYERHRLT RAQADAQELK NARDSAEVVE TAFCTFVLSR       120
     IAGEIASILD GLPLSVQRRF PELENRHVDF LKRDIIKAMN KAAALDELIP GLLSEYIEQS       180
     G                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page