(data stored in ACNUC7421 zone)

EMBL: CP001509.NUSB

CP001509.NUSB        Location/Qualifiers
FT   CDS             400538..400957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="ECD_00364"
FT                   /product="transcription antitermination protein"
FT                   /note="similar to b0416"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00364"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42263"
FT                   /protein_id="ACT42263.1"
FT                   /translation="MKPAARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDV
FT                   LYFRELLAGVATNTAYLDGLMKPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVAI
FT                   NEAIELAKSFGAEDSHKFVNGVLDKAAPVIRPNKK"
     MKPAARRRAR ECAVQALYSW QLSQNDIADV EYQFLAEQDV KDVDVLYFRE LLAGVATNTA        60
     YLDGLMKPYL SRLLEELGQV EKAVLRIALY ELSKRSDVPY KVAINEAIEL AKSFGAEDSH       120
     KFVNGVLDKA APVIRPNKK                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page