(data stored in ACNUC7421 zone)

EMBL: CP001509.O

CP001509.O           Location/Qualifiers
FT   CDS             761465..762364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="O"
FT                   /locus_tag="ECD_10024"
FT                   /product="DNA replication protein"
FT                   /note="similar to lambdap89"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10024"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42606"
FT                   /protein_id="ACT42606.1"
FT                   /translation="MTNTAKILNFGRGNFAGQERNVADLDDGYARLSNMLLEAYSGADL
FT                   TKRQFKVLLAILRKTYGWNKPMDRITDSQLSEITKLPVKRCNEAKLELVRMNIIKQQGG
FT                   MFGPNKNISEWCIPQNEGKSPKTRDKTSLKLGDCYPSKQGDTKDTITKEKRKDYSSENS
FT                   GESSDQPENDLSVVKPDAAIQSGSKWGTAEDLTAAEWMFDMVKTIAPSARKPNFAGWAN
FT                   DIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVTA
FT                   SKPKLDLTNTDWIYGVDL"
     MTNTAKILNF GRGNFAGQER NVADLDDGYA RLSNMLLEAY SGADLTKRQF KVLLAILRKT        60
     YGWNKPMDRI TDSQLSEITK LPVKRCNEAK LELVRMNIIK QQGGMFGPNK NISEWCIPQN       120
     EGKSPKTRDK TSLKLGDCYP SKQGDTKDTI TKEKRKDYSS ENSGESSDQP ENDLSVVKPD       180
     AAIQSGSKWG TAEDLTAAEW MFDMVKTIAP SARKPNFAGW ANDIRLMRER DGRNHRDMCV       240
     LFRWACQDNF WSGNVLSPAK LRDKWTQLEI NRNKQQAGVT ASKPKLDLTN TDWIYGVDL        299
//

If you have problems or comments...

PBIL Back to PBIL home page