(data stored in ACNUC7421 zone)

EMBL: CP001509.P

CP001509.P           Location/Qualifiers
FT   CDS             762361..763062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="P"
FT                   /locus_tag="ECD_10025"
FT                   /product="DNA replication protein"
FT                   /note="similar to lambdap61"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10025"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42607"
FT                   /protein_id="ACT42607.1"
FT                   /translation="MKNIAAQMVNFDREQMRRIANNMPEQYDEKPQVQQVAQIINGVFS
FT                   QLLATFPASLANRDQNEVNEIRRQWVLAFRENGITTMEQVNAGMRVARRQNRPFLPSPG
FT                   QFVAWCREEASVTAGLPNVSELVDMVYEYCRKRGLYPDAESYPWKSNAHYWLVTNLYQN
FT                   MRANALTDAELRRKAADELVHMTARINRGEAIPEPVKQLPVMGGRPLNRAQALAKIAEI
FT                   KAKFGLKGASV"
     MKNIAAQMVN FDREQMRRIA NNMPEQYDEK PQVQQVAQII NGVFSQLLAT FPASLANRDQ        60
     NEVNEIRRQW VLAFRENGIT TMEQVNAGMR VARRQNRPFL PSPGQFVAWC REEASVTAGL       120
     PNVSELVDMV YEYCRKRGLY PDAESYPWKS NAHYWLVTNL YQNMRANALT DAELRRKAAD       180
     ELVHMTARIN RGEAIPEPVK QLPVMGGRPL NRAQALAKIA EIKAKFGLKG ASV              233
//

If you have problems or comments...

PBIL Back to PBIL home page