(data stored in ACNUC7421 zone)

EMBL: CP001509.PAOC

CP001509.PAOC        Location/Qualifiers
FT   CDS             complement(268923..271121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paoC"
FT                   /locus_tag="ECD_00243"
FT                   /product="PaoABC aldehyde oxidoreductase, Moco-containing
FT                   subunit"
FT                   /note="similar to b0284"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00243"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42142"
FT                   /protein_id="ACT42142.1"
FT                   /translation="MKFDKPAGENPIDQLKVVGRPYDRIDGPLKTTGTARYAYEWHEES
FT                   PNAAYGYIVGSAMAKGRLTALDTDAAQKAPGVLAVITASNAGALGKGDKNTARLLGGPT
FT                   IEHYHQAIALVVAETFEQARAAASLVQAHYRRNKGAYSLADEKQAVSQPPEDTPDKNVG
FT                   DFDGAFTSAAVKIDATYTTPDQSHMAMEPHASMAVWDGNKLTLWTSNQMIDWCRTDLAK
FT                   TLKVPVENVRIISPYIGGGFGGKLFLRSDALLAALAARAVKRPVKVMLPRPTIPNNTTH
FT                   RPATLQHLRIGADQSGKITAISHESWSGNLPGGTPETAVQQSELLYAGANRHTGLRLAT
FT                   LDLPEGNAMRAPGEAPGLMALEIAIDELAEKAGIDPVEFRILNDTQVDPADPTRRFSRR
FT                   QLIECLRTGADKFGWKQRNATPGQVRDGEWLVGHGVAAGFRNNLLEKSGARVHLEPNGT
FT                   VTVETDMTDIGTGSYTILAQTAAEMLGVPLEQVAVHLGDSSFPVSAGSGGQWGANTSTS
FT                   GVYAACVKLREMIASAVGFDPEQSQFADGKITNGTRSAMLHEATAGGRLIAEESIEFGT
FT                   LSKEYQQSTFAGHFVEVGVHSATGEVRVRRMLAVCAAGRILNPKTARSQVIGAMTMGMG
FT                   AALMEELAVDDRLGYFVNHDMAGYEVPVHADIPKQEVIFLDDTDPISSPMKAKGVGELG
FT                   LCGVSAAIANAVYNATGIRVRDYPITLDKLLDKLPDVV"
     MKFDKPAGEN PIDQLKVVGR PYDRIDGPLK TTGTARYAYE WHEESPNAAY GYIVGSAMAK        60
     GRLTALDTDA AQKAPGVLAV ITASNAGALG KGDKNTARLL GGPTIEHYHQ AIALVVAETF       120
     EQARAAASLV QAHYRRNKGA YSLADEKQAV SQPPEDTPDK NVGDFDGAFT SAAVKIDATY       180
     TTPDQSHMAM EPHASMAVWD GNKLTLWTSN QMIDWCRTDL AKTLKVPVEN VRIISPYIGG       240
     GFGGKLFLRS DALLAALAAR AVKRPVKVML PRPTIPNNTT HRPATLQHLR IGADQSGKIT       300
     AISHESWSGN LPGGTPETAV QQSELLYAGA NRHTGLRLAT LDLPEGNAMR APGEAPGLMA       360
     LEIAIDELAE KAGIDPVEFR ILNDTQVDPA DPTRRFSRRQ LIECLRTGAD KFGWKQRNAT       420
     PGQVRDGEWL VGHGVAAGFR NNLLEKSGAR VHLEPNGTVT VETDMTDIGT GSYTILAQTA       480
     AEMLGVPLEQ VAVHLGDSSF PVSAGSGGQW GANTSTSGVY AACVKLREMI ASAVGFDPEQ       540
     SQFADGKITN GTRSAMLHEA TAGGRLIAEE SIEFGTLSKE YQQSTFAGHF VEVGVHSATG       600
     EVRVRRMLAV CAAGRILNPK TARSQVIGAM TMGMGAALME ELAVDDRLGY FVNHDMAGYE       660
     VPVHADIPKQ EVIFLDDTDP ISSPMKAKGV GELGLCGVSA AIANAVYNAT GIRVRDYPIT       720
     LDKLLDKLPD VV                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page