(data stored in ACNUC7421 zone)

EMBL: CP001509.PE20

CP001509.PE20        Location/Qualifiers
FT   CDS             complement(19658..20617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41922"
FT                   /protein_id="ACT41922.1"
FT                   /translation="MKWLLLITLSLYSFIVQSAPCALTNVGEQRGTYILKPLSMKGNLT
FT                   AEKIENTGNIIECTDLQETTNAIKVHFLTQNALKFKVGSRHYIINFPFEYDGKKIELPG
FT                   KSSYNLEEMLSAINFTIPYSIASVSDSSNTADIFPGTPFPLLFEIEVSSCTGNNTNCNS
FT                   VRFNYNLNTILQVNLMTCGFEDQSIDTGRFVLSRINNENYQFHHIRFDCIQGEQGELVF
FT                   EPSDVEYYFEPVTIQESGTSILKNELENSEDGAGQVGFQLSNDGTNEIQYGKSNYYSFQ
FT                   HPHEGSNQIPLFIRPRTYGNNVSSGQIMSRVKIVVMYN"
     MKWLLLITLS LYSFIVQSAP CALTNVGEQR GTYILKPLSM KGNLTAEKIE NTGNIIECTD        60
     LQETTNAIKV HFLTQNALKF KVGSRHYIIN FPFEYDGKKI ELPGKSSYNL EEMLSAINFT       120
     IPYSIASVSD SSNTADIFPG TPFPLLFEIE VSSCTGNNTN CNSVRFNYNL NTILQVNLMT       180
     CGFEDQSIDT GRFVLSRINN ENYQFHHIRF DCIQGEQGEL VFEPSDVEYY FEPVTIQESG       240
     TSILKNELEN SEDGAGQVGF QLSNDGTNEI QYGKSNYYSF QHPHEGSNQI PLFIRPRTYG       300
     NNVSSGQIMS RVKIVVMYN                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page