(data stored in ACNUC7421 zone)

EMBL: CP001509.PE21

CP001509.PE21        Location/Qualifiers
FT   CDS             complement(20630..21775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00021"
FT                   /product="putative usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00021"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41923"
FT                   /protein_id="ACT41923.1"
FT                   /translation="MAAWRYASQDYRTFSDHLYENDKHYHQSDYNDFYDIGRKNSLSAN
FT                   IMQPLSNNLGNVSLSALWRNYWGRSGNAKDYQFSYSNNWQHISYTFSASQSYDENNKEE
FT                   ERFNLFISIPFYWGDDIAKTRHQINLSNSTSFSKDGYSSNNTGITGIAGEHDQLNYGIY
FT                   VNQQQQNNDTSLGTNLSWRTPIAIIDGSYSHSKNAWQSGGSISSGLVVWSGGINITNQL
FT                   SDTFAILDAPGLEGAHINGQKYNRTNSKGQVVYDPIIPHRENHLVLDIANSESETELQG
FT                   NRQIIAPYRGAVSYVQFTTDQRKPWYIQALRPDGSPLTFGYDVLDLQENNIGVVGQGSR
FT                   LFIRVDEIPTGIKVALNDEQNLFCTITFQHVIDENKTYICQ"
     MAAWRYASQD YRTFSDHLYE NDKHYHQSDY NDFYDIGRKN SLSANIMQPL SNNLGNVSLS        60
     ALWRNYWGRS GNAKDYQFSY SNNWQHISYT FSASQSYDEN NKEEERFNLF ISIPFYWGDD       120
     IAKTRHQINL SNSTSFSKDG YSSNNTGITG IAGEHDQLNY GIYVNQQQQN NDTSLGTNLS       180
     WRTPIAIIDG SYSHSKNAWQ SGGSISSGLV VWSGGINITN QLSDTFAILD APGLEGAHIN       240
     GQKYNRTNSK GQVVYDPIIP HRENHLVLDI ANSESETELQ GNRQIIAPYR GAVSYVQFTT       300
     DQRKPWYIQA LRPDGSPLTF GYDVLDLQEN NIGVVGQGSR LFIRVDEIPT GIKVALNDEQ       360
     NLFCTITFQH VIDENKTYIC Q                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page