(data stored in ACNUC7421 zone)

EMBL: CP001509.PE212

CP001509.PE212       Location/Qualifiers
FT   CDS             242014..242385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00212"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42113"
FT                   /protein_id="ACT42113.1"
FT                   /translation="MESLPGVCILIWVIGCANAKVLKRCILPAPDGGVEKLSKPNLHGV
FT                   IKKVDLNTNEAEIKIKEGGAVSFIFNEETLYFTVFGGDFIMDYLKKVKNTEAWVWYKNC
FT                   DSKNKNVAVELLQIYELHQ"
     MESLPGVCIL IWVIGCANAK VLKRCILPAP DGGVEKLSKP NLHGVIKKVD LNTNEAEIKI        60
     KEGGAVSFIF NEETLYFTVF GGDFIMDYLK KVKNTEAWVW YKNCDSKNKN VAVELLQIYE       120
     LHQ                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page