(data stored in ACNUC7421 zone)

EMBL: CP001509.PE22

CP001509.PE22        Location/Qualifiers
FT   CDS             complement(22208..22912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00022"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41924"
FT                   /protein_id="ACT41924.1"
FT                   /translation="MPSRLIEKSAYCSTENMATNKFDVVFSYCGDNIKEFILLLPYNKS
FT                   LEMYELNDQKIQYLTAPNINIHKMSLSNITIEKSNLSYGYYFSCVLSNISCFESDLSNT
FT                   IFSNGEINNLFIKKSNIFGASFTNTRIKNLLCEDIMPGRWTTQLVNKHLGYRYTGVFKT
FT                   LASIDDKPSRFEILIPLVQTLVRDNVKLNNDVYKELKKFMHDYDKTSPEMRKYLQSINE
FT                   SMFLMKNIAHQN"
     MPSRLIEKSA YCSTENMATN KFDVVFSYCG DNIKEFILLL PYNKSLEMYE LNDQKIQYLT        60
     APNINIHKMS LSNITIEKSN LSYGYYFSCV LSNISCFESD LSNTIFSNGE INNLFIKKSN       120
     IFGASFTNTR IKNLLCEDIM PGRWTTQLVN KHLGYRYTGV FKTLASIDDK PSRFEILIPL       180
     VQTLVRDNVK LNNDVYKELK KFMHDYDKTS PEMRKYLQSI NESMFLMKNI AHQN             234
//

If you have problems or comments...

PBIL Back to PBIL home page