(data stored in ACNUC7421 zone)

EMBL: CP001509.PE25

CP001509.PE25        Location/Qualifiers
FT   CDS             complement(24054..24404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41927"
FT                   /protein_id="ACT41927.1"
FT                   /translation="MTDGISTSPHCLYKSNIVDDVIINKTRQNELVKVFCEYKTEFLIL
FT                   FDDFFRSQDFPKPSPVLHHFFQYTHLRDAHFYRCKLIEHTVQFYFLNTKASHYLDWMFL
FT                   MTEQANVFLKRW"
     MTDGISTSPH CLYKSNIVDD VIINKTRQNE LVKVFCEYKT EFLILFDDFF RSQDFPKPSP        60
     VLHHFFQYTH LRDAHFYRCK LIEHTVQFYF LNTKASHYLD WMFLMTEQAN VFLKRW           116
//

If you have problems or comments...

PBIL Back to PBIL home page