(data stored in ACNUC7421 zone)

EMBL: CP001509.PE26

CP001509.PE26        Location/Qualifiers
FT   CDS             complement(24701..24865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00026"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41928"
FT                   /protein_id="ACT41928.1"
FT                   /translation="MKKPAQAGFFMPAAFVMRERTHCRLPDSQKLQVLADMPLYYLNSS
FT                   WLKNRRTIG"
     MKKPAQAGFF MPAAFVMRER THCRLPDSQK LQVLADMPLY YLNSSWLKNR RTIG              54
//

If you have problems or comments...

PBIL Back to PBIL home page