(data stored in ACNUC7421 zone)

EMBL: CP001509.PE374

CP001509.PE374       Location/Qualifiers
FT   CDS             412484..413419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00376"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42275"
FT                   /protein_id="ACT42275.1"
FT                   /translation="MLTKRILFSVMLIVSPSVVASEKAHELYDSIYGGKPAPDVINTLH
FT                   KMAESGDIDAQSLLGWEYYQPRYDTKPDVQEAIKWFELAAKQGDREAPLALGGIYYDGE
FT                   QVRVDYAKAYALFNQAAQHGVNLAWSRLGIMYANGQYVEVDCKKAKEYLDKGVHIYGGP
FT                   EDFLATCRKDMIDRKTVDDTLPVITVTRSGMRDNFLDKGFSCMDSLFATTNKLGEVANL
FT                   RVTFSIRRPSGKEINQTVGFAPFGLNRLNISFTDYLFGSFTSNSSLILYKPEFERKSCA
FT                   TVRTTIVAATATINGKDVELLKAGAIEQKW"
     MLTKRILFSV MLIVSPSVVA SEKAHELYDS IYGGKPAPDV INTLHKMAES GDIDAQSLLG        60
     WEYYQPRYDT KPDVQEAIKW FELAAKQGDR EAPLALGGIY YDGEQVRVDY AKAYALFNQA       120
     AQHGVNLAWS RLGIMYANGQ YVEVDCKKAK EYLDKGVHIY GGPEDFLATC RKDMIDRKTV       180
     DDTLPVITVT RSGMRDNFLD KGFSCMDSLF ATTNKLGEVA NLRVTFSIRR PSGKEINQTV       240
     GFAPFGLNRL NISFTDYLFG SFTSNSSLIL YKPEFERKSC ATVRTTIVAA TATINGKDVE       300
     LLKAGAIEQK W                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page