(data stored in ACNUC7421 zone)

EMBL: CP001509.PE376

CP001509.PE376       Location/Qualifiers
FT   CDS             complement(414001..414378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00378"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42277"
FT                   /protein_id="ACT42277.1"
FT                   /translation="MIAVLCMRSTPYDFIQLIKEVIMPGKTATLPDVDKTLKNARVELK
FT                   TSPDAKNKLREAAQAVGVDLSAFILSAAMERAESVLDNQRRRELSNQSWELMNQLIAEP
FT                   AQPTLALKALMKRKNSDGRQA"
     MIAVLCMRST PYDFIQLIKE VIMPGKTATL PDVDKTLKNA RVELKTSPDA KNKLREAAQA        60
     VGVDLSAFIL SAAMERAESV LDNQRRRELS NQSWELMNQL IAEPAQPTLA LKALMKRKNS       120
     DGRQA                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page